RPP38 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP26869125UL

Catalog No. NB392950

Description

RPP38 Polyclonal antibody specifically detects RPP38 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: RPP38
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: EC 3.1.26.5, ribonuclease P (38kD) (RPP38), ribonuclease P protein subunit p38, ribonuclease P/MRP 38kDa subunit, RNaseP protein p38
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TDAKQQVSGWTPAHVRKQLAIGVNEVTRALERRELLLVLVCKSVKPAMITSHLIQLSLSRSVPACQVPRLSERIAPVIGLKCVLALAFK
• Quantity: 25 μL
• Research Discipline: Endocrinology
• Gene ID (Entrez): 10557
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified