Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RPS24 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RPS24 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RPS24 Polyclonal specifically detects RPS24 in Human samples. It is validated for Western Blot.Specifications
RPS24 | |
Polyclonal | |
Rabbit | |
P62847 | |
6229 | |
Synthetic peptides corresponding to RPS24(ribosomal protein S24) The peptide sequence was selected from the middle region of RPS24. Peptide sequence GFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGT. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DBA3,40S ribosomal protein S24, DKFZp686N1586, ribosomal protein S24 | |
RPS24 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title