Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RPS7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	RPS7
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15739420 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15739420UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP157394 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP157394	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

RPS7 Polyclonal specifically detects RPS7 in Human samples. It is validated for Western Blot.

Specifications

Antigen	RPS7
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	P62081
Gene ID (Entrez)	6201
Immunogen	Synthetic peptides corresponding to RPS7(ribosomal protein S7) The peptide sequence was selected from the N terminal of RPS7. Peptide sequence MFSSSAKIVKPNGEKPDEFESGISQALLELEMNSDLKAQLRELNITAAKE.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	DBA8,40S ribosomal protein S7, ribosomal protein S7
Gene Symbols	RPS7
Isotype	IgG

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

RPS7 Antibody, Novus Biologicals™

Specifications

Description

Specifications

missing translation for 'documents'