RPTOR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256133

Catalog No. NBP256133

Description

RPTOR Polyclonal specifically detects RPTOR in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: RPTOR
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: KIAA1303p150 target of rapamycin (TOR)-scaffold protein containing WD-repeats, KOG1, Mip1, p150 target of rapamycin (TOR)-scaffold protein, Raptor, regulatory associated protein of MTOR, complex 1, regulatory-associated protein of mTOR
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: RPTOR
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VSVSVNGDVRIFDPRMPESVNVLQIVKGLTALDIHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSV
• Quantity: 100 μL
• Research Discipline: Autophagy, Cancer, Hypoxia, mTOR Pathway, Signal Transduction
• Gene ID (Entrez): 57521
• Target Species: Human
• Isotype: IgG

For Research Use Only