Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Abnova™ RPTOR (Human) Recombinant Protein
Click to view available options
Quantity:
2 μg
Description
- Sequence: MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNCIQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSYNCTPVSSPRLPPTYMHAMW
Specifications
Specifications
Accession Number | AAH64515.1 |
Gene ID (Entrez) | 57521 |
Name | regulatory associated protein of MTOR, complex 1 |
Preparation Method | Wheat germ expression system |
Quality Control Testing | 125% SDS-PAGE Stained with Coomassie Blue |
Quantity | 2 μg |
Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Gene Alias | KOG1, Mip1 |
Gene Symbol | RPTOR |
Species | Wheat Germ (in vitro) |
Show More |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction