Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RPUSD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RPUSD2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RPUSD2 Polyclonal specifically detects RPUSD2 in Human samples. It is validated for Western Blot.Specifications
RPUSD2 | |
Polyclonal | |
Rabbit | |
NP_689473 | |
27079 | |
Synthetic peptide directed towards the C terminal of human RPUSD2. Peptide sequence AEHQAKQSLDVLDLCEGDLSPGLTDSTAPSSELGKDDLEELAAAAQKMEE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C15orf19, C18B11, C18B11 homolog (44.9kD), chromosome 15 open reading frame 19, FLJ31409, RNA pseudouridylate synthase domain containing 2, RNA pseudouridylate synthase domain-containing protein 2 | |
RPUSD2 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title