RREB1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25682425UL

Catalog No. NB403603

Description

RREB1 Polyclonal specifically detects RREB1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: RREB1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: DNA-binding protein, FINB, Finger protein in nuclear bodies, hindsight homolog, HNT, LZ321, Raf-responsive zinc finger protein LZ321, ras responsive element binding protein 1, ras-responsive element-binding protein 1, RREB-1, Zep-1, zinc finger motif enhancer binding protein 1, Zinc finger motif enhancer-binding protein 1, zinc finger motif-enhancer binding-protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: RREB1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSVPKAATTATPAATTSPKESSEPPAPASSPEAASPTEQGPAGTSKKRGRKRGMRSRPRANSGGVDLDSSGEFASIEKMLATTDTNKFSPF
• Quantity: 25 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 6239
• Target Species: Human
• Form: Purified

For Research Use Only