RRM1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158069

Catalog No. NBP158069

Description

RRM1 Polyclonal specifically detects RRM1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RRM1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 1.17.4.1, R1, ribonucleoside-diphosphate reductase large subunit, Ribonucleoside-diphosphate reductase subunit M1, Ribonucleotide reductase large subunit, ribonucleotide reductase M1, ribonucleotide reductase M1 polypeptide, ribonucleotide reductase, large subunit, ribonucleotide reductase, R1 subunit, RIR1, RR1
• Host Species: Rabbit
• Molecular Weight of Antigen: 90 kDa
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 6240
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P23921
• Gene Symbols: RRM1
• Immunogen: Synthetic peptides corresponding to RRM1(ribonucleotide reductase M1 polypeptide) The peptide sequence was selected from the C terminal of RRM1. Peptide sequence MHFYGWKQGLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEKER.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Xenopus: 92%; Chicken: 78%; Zebrafish: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

For Research Use Only