Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RRM2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RRM2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RRM2 Polyclonal specifically detects RRM2 in Human samples. It is validated for Western Blot.Specifications
RRM2 | |
Polyclonal | |
Rabbit | |
Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers | |
EC 1.17.4.1, R2, ribonucleoside-diphosphate reductase subunit M2, ribonucleotide reductase M2, ribonucleotide reductase M2 polypeptide, Ribonucleotide reductase small chain, Ribonucleotide reductase small subunit, RR2, RR2M | |
RRM2 | |
IgG | |
This product is specific to Subunit or Isoform: M2. |
Western Blot | |
Unconjugated | |
RUO | |
P31350 | |
6241 | |
Synthetic peptides corresponding to RRM2(ribonucleotide reductase M2 polypeptide) The peptide sequence was selected from the N terminal of RRM2. Peptide sequence PALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFP. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title