Invitrogen™ RRM2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579937

Catalog No. PIPA579937

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Cardiac Muscle Tissue, Mouse Cardiac Muscle Tissue, A431 whole cell, HELA whole cell. IHC: human mammary cancer tissue.

RRM2 is one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the protein (M2) is regulated in a cell-cycle dependent fashion.

Specifications

• Antigen: RRM2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: RRM2
• Gene Alias: AA407299; R2; ribonucleoside-diphosphate reductase M2 chain; ribonucleoside-diphosphate reductase subunit M2; Ribonucleotide reductase 2; ribonucleotide reductase M2; ribonucleotide reductase M2 polypeptide; ribonucleotide reductase regulatory subunit M2; ribonucleotide reductase small chain; Ribonucleotide reductase small subunit; RR2; RR2M; RRM2; RRR2M
• Host Species: Rabbit
• Purification Method: Antigen Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 20135, 362720, 6241
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P11157, P31350, Q4KLN6
• Gene Symbols: RRM2
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human RRM2 (1-33aa MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENT).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov