Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RRP4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25848125UL
Description
RRP4 Polyclonal specifically detects RRP4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
RRP4 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
exosome component 2Ribosomal RNA-processing protein 4, homolog of yeast RRP4 (ribosomal RNA processing 4), 3' 5' exoribonuclease(RRP4), homolog of yeast RRP4 (ribosomal RNA processing 4), 3'-5'-exoribonuclease, hRrp4p, p7, RRP4exosome complex exonuclease RRP4, Rrp4p | |
Rabbit | |
Affinity Purified | |
RUO | |
23404 | |
Human | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
EXOSC2 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:WKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTH | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction