RSK3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB395974	Novus Biologicals NBP24882525UL	25 μL

Description

RSK3 Polyclonal antibody specifically detects RSK3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: RSK3
• Applications: Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: Protein Kinase
• Formulation: PBS (pH 7.2), 40% Glycerol
• Gene ID (Entrez): 6196
• Isotype: IgG
• Purification Method: Immunogen affinity purified

• Dilution: Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: EC 2.7.11, EC 2.7.11.1, HU-2, MAP kinase-activated protein kinase 1c, MAPK-activated protein kinase 1c, MAPKAP kinase 1c, MAPKAPK-1c, MAPKAPK1C, p90-RSK 2, p90RSK2, p90-RSK3, ribosomal protein S6 kinase alpha 2, ribosomal protein S6 kinase alpha-2, ribosomal protein S6 kinase, 90kD, polypeptide 2, ribosomal protein S6 kinase, 90kDa, polypeptide 2, Ribosomal S6 kinase 3,90 kDa ribosomal protein S6 kinase 2, RSK, RSK-3, RSK3pp90RSK3, S6K-alpha, S6K-alpha2, S6K-alpha-2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MDLSMKKFAVRRFFSVYLRRKSRSKSSSLSRLEEEGVVKEIDISHHVKEGF
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.