Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RSPRY1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RSPRY1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RSPRY1 Polyclonal specifically detects RSPRY1 in Human samples. It is validated for Western Blot.Specifications
RSPRY1 | |
Polyclonal | |
Rabbit | |
Q96DX4 | |
89970 | |
Synthetic peptides corresponding to RSPRY1(ring finger and SPRY domain containing 1) The peptide sequence was selected from the N terminal of RSPRY1. Peptide sequence RSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQEPPY. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
KIAA1972RING finger and SPRY domain-containing protein 1, ring finger and SPRY domain containing 1 | |
RSPRY1 | |
IgG | |
64 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title