Learn More
Abnova™ RTN4 Recombinant Protein
Shop All Abnova Corporation ProductsDescription
This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. The product of this gene is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates. Alternatively spliced transcript variants derived both from differential splicing and differential promoter usage and encoding different isoforms have been identified
- Theoretical MW (kDa): 47.63
- Preparation method: In vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer
Sequence: MDGQKKNWKDKVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE
Best when used within three months from the date of receipt.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
Specifications
Accession Number | AAH01035 |
For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
Formulation | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
Gene ID (Entrez) | 57142 |
Molecular Weight (g/mol) | 47.63 |
Name | RTN4 (Human) Recombinant Protein (P01) |
pH Range | 8 |
Preparation Method | In vitro wheat germ expression system |
Purification Method | Glutathione Sepharose 4 Fast Flow |
Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Show More |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.