Rubicon Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24913425UL

Catalog No. NB395834

Description

Rubicon Polyclonal antibody specifically detects Rubicon in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Rubicon
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: Baron, Beclin 1-interacting protein, Beclin-1 Associated RUN Domain Containing Protein, KIAA0226, Rubicon, RUN And Cysteine Rich Domain Containing Beclin 1 Interacting Protein, RUN Domain And Cysteine-Rich Domain Containing, Beclin 1-Interacting Protein, Run Domain Beclin-1-Interacting And Cysteine-Rich Domain-Containing Protein, rundataxin, SCAR15
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RSHSDTSIASRGAPESCNDKAKLRGPLPYSGQSSEVSTPSSLYMEYEGGRYLCSGEGMFRRPSEGQSLISYLSEQDFGSCADLEKENAHFS
• Quantity: 25 μL
• Research Discipline: Autophagy, Cancer, Cardiovascular Biology, Cell Biology, Endocrinology, Signal Transduction
• Gene ID (Entrez): 9711
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified