Learn More
Description
Specifications
Specifications
| Antigen | RUNX1/CBFA2 |
| Applications | ChIP Assay-exo-Seq, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | Acute myeloid leukemia 1 protein, AML1acute myeloid leukemia 1, AML1-EVI-1, CBFA2acute myeloid leukemia 1 protein (oncogene AML-1), core-binding factor, alphasubunit10AMLCR1, Core-binding factor subunit alpha-2, EVI-1, PEBP2A2, runt domain, alpha subunit 2, runt-related transcription factor 1, SL3/AKV core-binding factor alpha B subunit |
| Gene Symbols | RUNX1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
