RUNX1/CBFA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255213

Catalog No. NBP255213

Description

RUNX1/CBFA2 Polyclonal specifically detects RUNX1/CBFA2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: RUNX1/CBFA2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: Acute myeloid leukemia 1 protein, AML1acute myeloid leukemia 1, AML1-EVI-1, CBFA2acute myeloid leukemia 1 protein (oncogene AML-1), core-binding factor, alphasubunit10AMLCR1, Core-binding factor subunit alpha-2, EVI-1, PEBP2A2, runt domain, alpha subunit 2, runt-related transcription factor 1, SL3/AKV core-binding factor alpha B subunit
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: RUNX1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN
• Quantity: 100 μL
• Research Discipline: Cancer, Tumor Suppressors
• Gene ID (Entrez): 861
• Target Species: Human
• Isotype: IgG

For Research Use Only