RUNX3/CBFA3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238863

Catalog No. NBP238863

Description

RUNX3/CBFA3 Polyclonal specifically detects RUNX3/CBFA3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RUNX3/CBFA3
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q13761
• Gene Symbols: RUNX3
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELNP
• Quantity: 0.1 mL
• Research Discipline: Transcription Factors and Regulators
• Gene ID (Entrez): 864
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Acute myeloid leukemia 2 protein, AML2SL3/AKV core-binding factor alpha C subunit, CBFA3MGC16070, CBF-alpha-3, PEA2 alpha C, PEA2-alpha C, PEBP2 alpha C, PEBP2A3FLJ34510, PEBP2-alpha C, runt domain, alpha subunit 3, runt-related transcription factor 3, SL3-3 enhancer factor 1 alpha C subunit, transcription factor AML2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.