Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ RXFP2 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595582
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595582 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595582 Supplier Invitrogen™ Supplier No. PA595582
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human SHG-44 whole cell. Flow: U251 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The activity of this relaxin receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP and may also be a receptor for Leydig insulin-like peptide. Expressed in embryonic and adult gonads of males and females, as well in male gubernarculum and in brain. Not detected in kidney, spleen and heart.
TRUSTED_SUSTAINABILITY

Specifications

Antigen RXFP2
Applications Flow Cytometry, Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene RXFP2
Gene Accession No. Q8WXD0
Gene Alias G protein coupled receptor affecting testicular descent; G protein-coupled receptor 106; Gpcr; GPR106; G-protein coupled receptor 106; G-protein coupled receptor affecting testicular descent; GREAT; INSL3 receptor; INSL3R; leucine-rich repeat-containing G protein-coupled receptor 8; leucine-rich repeat-containing G-protein coupled receptor 8; Lgr8; LGR8.1; Relaxin family peptide receptor 2; relaxin receptor 2; relaxin/insulin like family peptide receptor 2; relaxin/insulin-like family peptide receptor 2; Rxfp2; RXFPR2
Gene Symbols RXFP2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human GPCR LGR8 (MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQ).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 122042
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.