Invitrogen™ RXFP2 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595582

Catalog No. PIPA595582

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human SHG-44 whole cell. Flow: U251 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The activity of this relaxin receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP and may also be a receptor for Leydig insulin-like peptide. Expressed in embryonic and adult gonads of males and females, as well in male gubernarculum and in brain. Not detected in kidney, spleen and heart.

Specifications

• Antigen: RXFP2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: RXFP2
• Gene Alias: G protein coupled receptor affecting testicular descent; G protein-coupled receptor 106; Gpcr; GPR106; G-protein coupled receptor 106; G-protein coupled receptor affecting testicular descent; GREAT; INSL3 receptor; INSL3R; leucine-rich repeat-containing G protein-coupled receptor 8; leucine-rich repeat-containing G-protein coupled receptor 8; Lgr8; LGR8.1; Relaxin family peptide receptor 2; relaxin receptor 2; relaxin/insulin like family peptide receptor 2; relaxin/insulin-like family peptide receptor 2; Rxfp2; RXFPR2
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 122042
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: Q8WXD0
• Gene Symbols: RXFP2
• Immunogen: A synthetic peptide corresponding to a sequence of human GPCR LGR8 (MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQ).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov