S100A11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB438621	Novus Biologicals NBP21327025UL	25ul
NBP213270	Novus Biologicals NBP213270	0.1 mL

Description

S100A11 Polyclonal specifically detects S100A11 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: S100A11
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cell Cycle and Replication
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 6282
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: SLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSF
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Concentration: 0.05mg/mL
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: calgizzarin, Metastatic lymph node gene 70 protein, MLN 70, MLN70, protein S100-A11, Protein S100-C, S100 calcium binding protein A11, S100 calcium-binding protein A11, S100 calcium-binding protein A11 (calgizzarin), S100CS100 calcium binding protein A11 (calgizzarin)
• Gene Symbols: S100A11
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only