Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
S100A7/Psoriasin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$382.00 - $610.00
Specifications
| Antigen | S100A7/Psoriasin |
|---|---|
| Dilution | Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:500-1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
S100A7/Psoriasin Polyclonal specifically detects S100A7/Psoriasin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| S100A7/Psoriasin | |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| P31151 | |
| 6278 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:EKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:500-1:1000 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| HID 5, HID5, HID-5, protein S100-A7, PSOR1, Psoriasin, psoriasin 1, S100 calcium binding protein A7, S100 calcium binding protein A7 (psoriasin 1), S100 calcium-binding protein A7, S100 calcium-binding protein A7 (psoriasin 1), S100A7c | |
| S100A7 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title