Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
S100A8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
$274.85 - $665.78
Specifications
| Antigen | S100A8 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200-1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
S100A8 Polyclonal specifically detects S100A8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| S100A8 | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 6279 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKM | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:200-1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 60B8AG, CAGACP-10, calgranulin A, calgranulin-A, Calprotectin L1L subunit, CFAGL1Ag, CGLA, Cystic fibrosis antigen, Leukocyte L1 complex light chain, MA387, MIF, Migration inhibitory factor-related protein 8, MRP-8, MRP8S100 calcium binding protein A8 (calgranulin A), NIF, P8, protein S100-A8, S100 calcium binding protein A8, S100 calcium-binding protein A8, S100 calcium-binding protein A8 (calgranulin A), Urinary stone protein band A | |
| S100A8 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title