Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
S100P Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | S100P |
---|---|
Dilution | Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
S100P Polyclonal specifically detects S100P in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
S100P | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
MIG9, migration-inducing gene 9, Protein S100-E, S100 calcium binding protein P, S100 calcium-binding protein Pprotein S100-P, S100E | |
S100P | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
Polyclonal | |
Rabbit | |
Cancer | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
6286 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEF | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title