S1P1/EDG-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258024

Catalog No. NBP258024

Description

S1P1/EDG-1 Polyclonal specifically detects S1P1/EDG-1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: S1P1/EDG-1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: CD363, CD363 antigen, CHEDG1, D1S3362, EDG-1, EDG1edg-1, Endothelial differentiation G-protein coupled receptor 1, endothelial differentiation, sphingolipid G-protein-coupled receptor, 1, FLJ58121, S1P receptor 1, S1P receptor Edg-1, s1p1, S1P1ECGF1, sphingosine 1-phosphate receptor 1, sphingosine 1-phosphate receptor EDG1, Sphingosine 1-phosphate receptor Edg-1, sphingosine-1-phosphate receptor 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: S1PR1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYT
• Quantity: 100 μL
• Research Discipline: Cancer, Cytoskeleton Markers, GPCR, Lipid and Metabolism, Neuroscience, Signal Transduction
• Gene ID (Entrez): 1901
• Target Species: Human
• Isotype: IgG

For Research Use Only