Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
S5a/Angiocidin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | Proteasome 19S S5A |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
S5a/Angiocidin Polyclonal specifically detects S5a/Angiocidin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Proteasome 19S S5A | |
| Polyclonal | |
| Rabbit | |
| Human | |
| P55036 | |
| 5710 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: AESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 26S proteasome non-ATPase regulatory subunit 4, 26S proteasome regulatory subunit S5A, AF-1,26S protease subunit S5a, AFMCB1, angiocidin, Antisecretory factor 1, ASF, multiubiquitin chain binding protein, Multiubiquitin chain-binding protein, proteasome (prosome, macropain) 26S subunit, non-ATPase, 4, pUB-R5,26S proteasome regulatory subunit RPN10, Rpn10, RPN10 homolog, S5A, S5a/antisecretory factor protein | |
| PSMD4 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title