SACM1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB433867	Novus Biologicals NBP18147025UL	25ul
NBP181470	Novus Biologicals NBP181470	0.1 mL

Description

SACM1L Polyclonal specifically detects SACM1L in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SACM1L
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: DKFZp686A0231, EC 3.1.3, EC 3.1.3.36, EC 3.1.3.77, KIAA0851suppressor of actin 1, phosphatidylinositide phosphatase SAC1, SAC1 suppressor of actin mutations 1-like (yeast), SAC1EC 3.1.3.-, Suppressor of actin mutations 1-like protein
• Gene Symbols: SACM1L
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Stem Cell Markers
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 22908
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VIINLINQKGSEKPLEQTFATMVSSLGSGMMRYIAFDFHKECKNMRWDRLSILLDQVAEMQDELSYFLVDSAGQVVANQEGVFRS
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only