Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SAM68 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23864525UL
Description
SAM68 Polyclonal specifically detects SAM68 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
SAM68 | |
Polyclonal | |
Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Q07666 | |
KHDRBS1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: YDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTRPSLKAPPARPVKGAYR | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
FLJ34027, GAP-associated tyrosine phosphoprotein p62, KH domain containing, RNA binding, signal transduction associated 1, KH domain-containing, RNA-binding, signal transduction-associated protein 1, p21 Ras GTPase-activating protein-associated p62, p62, p68, SAM68, Sam68GAP-associated tyrosine phosphoprotein p62 (Sam68), Src-associated in mitosis 68 kDa protein | |
Rabbit | |
Affinity Purified | |
RUO | |
10657 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction