Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP182599

SAMSN1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP182599 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP182599 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP182599 Supplier Novus Biologicals Supplier No. NBP182599
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

SAMSN1 Polyclonal specifically detects SAMSN1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen SAMSN1
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.05mg/mL
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias HACS1gene with homology to KIAA0790 protein10NASH1, Hematopoietic adaptor containing SH3 and SAM domains 1, SAM and SH3 domain containing 1, SAM and SH3 domain containing 2, SAM domain, SH3 domain and nuclear localisation signals, 1, SAM domain, SH3 domain and nuclear localization signals 1, SAM domain, SH3 domain and nuclear localization signals protein 1, SAM domain-containing protein SAMSN-1, SH3D6B, SH3-SAM adaptor protein
Gene Symbols SAMSN1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TEAHEGDPTNGSGEQSKTSNNGGGLGKKMRAISWTMKKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSLKASDSMDSLYSGQSSSSGITSCSDGTSNRDSFRLDDDGPYSGPFC
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 64092
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.