Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SAPS1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15781520UL
Description
SAPS1 Polyclonal specifically detects SAPS1 in Human samples. It is validated for Western Blot.Specifications
SAPS1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
KIAA1115MGC138185, PP6R1MGC142003, protein phosphatase 6, regulatory subunit 1, SAP190, SAPS domain family member 1, SAPS domain family, member 1, SAPS1serine/threonine-protein phosphatase 6 regulatory subunit 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
22870 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
PPP6R1 | |
Synthetic peptides corresponding to PPP6R1 (protein phosphatase 6, regulatory subunit 1) Antibody(against the N terminal of PPP6R1. Peptide sequence MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQ. | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title