Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SAPS1 Antibody, Novus Biologicals™

SAPS1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15781520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15781520 20 μL
NBP157815 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15781520 Supplier Novus Biologicals Supplier No. NBP15781520UL

Description

Rabbit Polyclonal Antibody

SAPS1 Polyclonal specifically detects SAPS1 in Human samples. It is validated for Western Blot.

Specifications

Antigen SAPS1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias KIAA1115MGC138185, PP6R1MGC142003, protein phosphatase 6, regulatory subunit 1, SAP190, SAPS domain family member 1, SAPS domain family, member 1, SAPS1serine/threonine-protein phosphatase 6 regulatory subunit 1
Gene Symbols PPP6R1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PPP6R1 (protein phosphatase 6, regulatory subunit 1) Antibody(against the N terminal of PPP6R1. Peptide sequence MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQ.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 22870
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.