SAR1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP233521

Catalog No. NBP233521

Description

SAR1B Polyclonal specifically detects SAR1B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SAR1B
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q9Y6B6
• Gene Symbols: SAR1B
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TLLHMLKDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHE
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 51128
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 2310075M17Rik, ANDD, CMRD, EC 3.6.5, GTP-binding protein B, GTP-binding protein SAR1b, GTP-binding protein Sara, SAR1 homolog B (S. cerevisiae), SAR1a gene homolog (S. cerevisiae) 2, SAR1a gene homolog 2, SAR1a gene homolog 2 (S. cerevisiae), SARA2GTBPB, SARB
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only