SAR1B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310007100UL

Catalog No. NB124915

Description

SAR1B Polyclonal specifically detects SAR1B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SAR1B
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: 2310075M17Rik, ANDD, CMRD, EC 3.6.5, GTP-binding protein B, GTP-binding protein SAR1b, GTP-binding protein Sara, SAR1 homolog B (S. cerevisiae), SAR1a gene homolog (S. cerevisiae) 2, SAR1a gene homolog 2, SAR1a gene homolog 2 (S. cerevisiae), SARA2GTBPB, SARB
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SAR1B (NP_001028675.1). Peptide sequence RPEAISEERLREMFGLYGQTTGKGSISLKELNARPLEVFMCSVLKRQGYG
• Quantity: 100 μg
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 51128
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified