SARDH Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP170769

Catalog No. NBP170769

Description

SARDH Polyclonal specifically detects SARDH in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SARDH
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: SARDH
• Immunogen: Synthetic peptides corresponding to SARDH(sarcosine dehydrogenase) The peptide sequence was selected from the middle region of SARDH. Peptide sequence DHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQ.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1757
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Zebrafish
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Alias: BPR-2, dimethylglycine dehydrogenase-like 1, DMGDHL1, FLJ36475, mitochondrial, SAR, sarcosine dehydrogenase, SARD, SDH
• Host Species: Rabbit
• Molecular Weight of Antigen: 101 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only