Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SARG Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SARG |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SARG Polyclonal specifically detects SARG in Human samples. It is validated for Western Blot.Specifications
SARG | |
Polyclonal | |
Rabbit | |
chromosome 1 open reading frame 116, DKFZp666H2010, MGC2742 | |
C1ORF116 | |
IgG | |
37 kDa |
Western Blot | |
Unconjugated | |
RUO | |
79098 | |
Synthetic peptides corresponding to C1ORF116 The peptide sequence was selected from the middle region of C1ORF116. Peptide sequence SGLTLQESNTPGLRQMNFKSNTLERSGVGLSSYLSTEKDASPKTSTSLGK. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title