Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SARP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$464.00
Specifications
Antigen | SARP |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SARP Polyclonal specifically detects SARP in Human samples. It is validated for Western Blot.Specifications
SARP | |
Polyclonal | |
Rabbit | |
ankyrin repeat domain 42 | |
ANKRD42 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
338699 | |
Synthetic peptides corresponding to ANKRD42 (ankyrin repeat domain 42) The peptide sequence was selected from the N terminal of ANKRD42. Peptide sequence PLHLAATHGHSFTLQIMLRSGVDPSVTDKREWRPVHYAAFHGRLGCLQLL. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title