Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SARS-CoV-2 nsp12 Rabbit anti-SARS-CoV-2, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$148.20 - $378.00

Specifications

Antigen	SARS-CoV-2 nsp12
Dilution	Western Blot 1:500 - 1:2000
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB167064 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP31598420UL	20 μg	Each for $148.20	Only null left	Sign In or Register to check your price. Add to Cart

NB167063 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP315984100UL	100 μg	Each for $378.00	Only null left	Sign In or Register to check your price. Add to Cart

Description

SARS-CoV-2 nsp12 Polyclonal antibody specifically detects SARS-CoV-2 nsp12 in SARS-CoV-2 samples. It is validated for Western Blot

Specifications

Antigen	SARS-CoV-2 nsp12
Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Infections (Virus Bacteria and Parasites)
Formulation	PBS, 50% glycerol, pH7.3
Gene ID (Entrez)	43740578
Isotype	IgG
Purification Method	Affinity purified

Dilution	Western Blot 1:500 - 1:2000
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Target Species	SARS-CoV-2
Gene Alias	Non-structural protein 12, nsp12, ORF1a polyprotein, ORF1ab polyprotein, pp1a, Replicase polyprotein 1a
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 200-300 of coronavirus NSP12 (YP_009725307.1). GIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQTYHPNCVN
Primary or Secondary	Primary
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

SARS-CoV-2 nsp12 Rabbit anti-SARS-CoV-2, Polyclonal, Novus Biologicals™

Specifications

Description

Specifications

Documents