Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SARS-CoV-2 ORF9b Rabbit anti-SARS-CoV-2, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$159.60 - $389.00

Specifications

Antigen	SARS-CoV-2 ORF9b
Dilution	Western Blot 1:500 - 1:2000
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB167072 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP31598820UL	20 μg	Each for $159.60	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB167071 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP315988100UL	100 μg	Each for $389.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

SARS-CoV-2 ORF9b Polyclonal antibody specifically detects SARS-CoV-2 ORF9b in SARS-CoV-2 samples. It is validated for Western Blot

Specifications

Antigen	SARS-CoV-2 ORF9b
Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Infections (Virus Bacteria and Parasites)
Formulation	PBS, 50% glycerol, pH7.3
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-97 of coronavirus ORF9b (P0DTD2). MDPKISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK
Primary or Secondary	Primary
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.

Dilution	Western Blot 1:500 - 1:2000
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Target Species	SARS-CoV-2
Gene Alias	Accessory protein 9b, ORF9b, ORF-9b, Protein 9b
Isotype	IgG
Purification Method	Affinity purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

SARS-CoV-2 ORF9b Rabbit anti-SARS-CoV-2, Polyclonal, Novus Biologicals™

Specifications

Description

Specifications

Documents