Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SARS Nucleocapsid Protein Antibody (AP201054), Alexa Fluor™ 532, Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP290967AF532
Description
SARS Nucleocapsid Protein Monoclonal antibody specifically detects SARS Nucleocapsid Protein in SARS-CoV, SARS-CoV-2 samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoassay, Direct ELISASpecifications
SARS Nucleocapsid Protein | |
Monoclonal | |
Alexa Fluor 532 | |
50mM Sodium Borate | |
Mouse | |
Protein G purified | |
RUO | |
Primary | |
SARS-CoV, SARS-CoV-2 | |
Purified |
Western Blot, ELISA, Immunocytochemistry, Immunoassay, Direct ELISA | |
AP201054 | |
Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoassay, Direct ELISA | |
N, N protein, N structural protein, NC, Nucleocapsid protein, Nucleoprotein, Protein N, SARS coronavirus N protein, SARS coronavirus nucleocapsid protein, SARS CoV, SARS CoV N protein, SARS CoV nucleocapsid protein, SARS N protein, SARS Nucleoprotein, SARSCoV, SARSCoV N protein, SARSCoV nucleocapsid protein, Severe acute respiratory syndrome | |
The antibody was developed by immunizing mice with a with a protein fragment corresponding to amino acids 1-49 (C-MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNN) from the N (SARS Nucleocapsid) for the Human SARS coronavirus (Genbank accession no. NP_828858.1) | |
0.1 mL | |
Infections (Virus Bacteria and Parasites) | |
1489678 | |
Store at 4C in the dark. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction