SARS Nucleocapsid Protein Antibody (AP201054) - Azide and BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP290967

Catalog No. NB025738

Description

SARS Nucleocapsid Protein Monoclonal antibody specifically detects SARS Nucleocapsid Protein in SARS-CoV, SARS-CoV-2 samples. It is validated for Western Blot, ELISA, Immunocytochemistry, Immunofluorescence, Immunoassay.

Specifications

• Antigen: SARS Nucleocapsid Protein
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: Lyophilized from a 0.2 μm filtered solution in PBS with No Preservative
• Host Species: Mouse
• Purification Method: Protein G purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1489678
• Target Species: SARS-CoV, SARS-CoV-2
• Form: Lyophilized

• Applications: Western Blot, ELISA, Immunocytochemistry, Immunofluorescence, Immunoassay
• Clone: AP201054
• Dilution: Western Blot 1:1000, ELISA, Immunocytochemistry/Immunofluorescence, Immunoassay, Direct ELISA
• Gene Alias: COVID-19 nucleocapsid protein, N, N protein, N structural protein, NC, Nucleocapsid protein, Nucleoprotein, Protein N, SARS coronavirus N protein, SARS coronavirus nucleocapsid protein, SARS CoV, SARS CoV N protein, SARS CoV nucleocapsid protein, SARS N protein, SARS Nucleoprotein, SARSCoV, SARSCoV N protein, SARSCoV nucleocapsid protein, SARSCOV2 N protein, SARS-COV-2 nucleocapsid protein, SARS-COV-2 Nucleoprotein, Severe acute respiratory syndrome
• Immunogen: The antibody was developed by immunizing mice with a with a protein fragment corresponding to amino acids 1-49 (C-MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNN) from the N (SARS Nucleocapsid) for the Human SARS coronavirus (Genbank accession no. NP_828858.1)
• Quantity: 100 μg
• Primary or Secondary: Primary
• Reconstitution: Reconstitute with sterilized PBS to a final concentration is 0.5 mg/ml. Aliquot and store frozen at <−20 for at least for six months without detectable loss of activity. Avoid repeated freeze-thaw cycles.
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG