SC5DL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP160053

Catalog No. NBP160053

Description

SC5DL Polyclonal specifically detects SC5DL in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SC5DL
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 3beta-hydroxysteroid-delta5-desaturase, C-5 sterol desaturase, Delta(7)-sterol 5-desaturase, EC 1.14.21.6, ERG3, fungal ERG3, delta-5-desaturase-like, Lathosterol 5-desaturase, lathosterol dehydrogenase, lathosterol oxidase, S5DES, SC5D, Sterol-C5-desaturase, sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, fungal)-like, sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, S. cerevisiae)-like, sterol-C5-desaturase (fungal ERG3, delta-5-desaturase)-like
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6309
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O75845
• Gene Symbols: SC5DL
• Immunogen: Synthetic peptides corresponding to SC5DL(sterol-C5-desaturase (ERG3 delta-5-desaturase homolog, S. cerevisiae)-like) The peptide sequence was selected from the N terminal of SC5DL. Peptide sequence NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELV The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human
• Isotype: IgG

For Research Use Only