Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SCAND2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SCAND2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SCAND2 Polyclonal specifically detects SCAND2 in Human samples. It is validated for Western Blot.Specifications
SCAND2 | |
Polyclonal | |
Rabbit | |
SCAN domain containing 2 pseudogene | |
SCAND2 | |
IgG | |
18 kDa |
Western Blot | |
Unconjugated | |
RUO | |
54581 | |
Synthetic peptide directed towards the middle region of human SCAND2The immunogen for this antibody is SCAND2. Peptide sequence IQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title