Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SCAND3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179265
Description
SCAND3 Polyclonal specifically detects SCAND3 in Human samples. It is validated for Western Blot.Specifications
SCAND3 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
SCAND3 | |
Synthetic peptide directed towards the n terminal of human ZNF452. Peptide sequence SRQRFRQFCYQETPGPREALSQLRELCRQWLNPEIHTKEQILELLVLEQF. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Western Gorilla: 100%; Canine: 100%; Bovine: 100%; Human: 100%; Chimpanzee: 100%; Pig-tailed macaque: 100%; Rhesus macaque: 100%; Common woolly monkey: 100%; Black-handed spider monkey: 100%; Pygmy chimpanzee: 100%; Red-chested mustached tamarin: 100%; Mouse: 92%; Bornean orangutan: 92%; Lowland gorilla: 92%; Crab-eating macaque: 85%; Sumatran orangutan: 84%; Rat: 84%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
dJ1186N24.3, dJ1186N24.3 (novel zinc finger protein), SCAN domain containing 3, ZNF305P2, ZNF452 | |
Rabbit | |
Affinity purified | |
RUO | |
114821 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction