SCAND3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179265

Catalog No. NBP179265

Description

SCAND3 Polyclonal specifically detects SCAND3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SCAND3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: SCAND3
• Immunogen: Synthetic peptide directed towards the n terminal of human ZNF452. Peptide sequence SRQRFRQFCYQETPGPREALSQLRELCRQWLNPEIHTKEQILELLVLEQF.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Western Gorilla: 100%; Canine: 100%; Bovine: 100%; Human: 100%; Chimpanzee: 100%; Pig-tailed macaque: 100%; Rhesus macaque: 100%; Common woolly monkey: 100%; Black-handed spider monkey: 100%; Pygmy chimpanzee: 100%; Red-chested mustached tamarin: 100%; Mouse: 92%; Bornean orangutan: 92%; Lowland gorilla: 92%; Crab-eating macaque: 85%; Sumatran orangutan: 84%; Rat: 84%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: dJ1186N24.3, dJ1186N24.3 (novel zinc finger protein), SCAN domain containing 3, ZNF305P2, ZNF452
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 114821
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.