Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SCAND3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SCAND3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SCAND3 Polyclonal specifically detects SCAND3 in Human samples. It is validated for Western Blot.Specifications
SCAND3 | |
Polyclonal | |
Rabbit | |
NP_443155 | |
114821 | |
Synthetic peptide directed towards the C terminal of human SCAND3The immunogen for this antibody is SCAND3. Peptide sequence ETGFSTLSVIKTKHRNSLNIHYPLRVALSSIQPRLDKLTSKKQAHLSH. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
dJ1186N24.3, dJ1186N24.3 (novel zinc finger protein), SCAN domain containing 3, ZNF305P2, ZNF452 | |
SCAND3 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title