Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SCAND3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | SCAND3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179266
|
Novus Biologicals
NBP179266 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
SCAND3 Polyclonal specifically detects SCAND3 in Human samples. It is validated for Western Blot.Specifications
SCAND3 | |
Polyclonal | |
Rabbit | |
NP_443155 | |
114821 | |
Synthetic peptide directed towards the C terminal of human SCAND3The immunogen for this antibody is SCAND3. Peptide sequence ETGFSTLSVIKTKHRNSLNIHYPLRVALSSIQPRLDKLTSKKQAHLSH. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
dJ1186N24.3, dJ1186N24.3 (novel zinc finger protein), SCAN domain containing 3, ZNF305P2, ZNF452 | |
SCAND3 | |
IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title