Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SCCPDH Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP317042100UL
This item is not returnable.
View return policy
Description
SCCPDH Polyclonal antibody specifically detects SCCPDH in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
SCCPDH | |
Polyclonal | |
Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
CGI-49, EC 1.5.1.9, FLJ43187, NET11, probable saccharopine dehydrogenase, RP11-439E19.2, saccharopine dehydrogenase (putative) | |
This antibody was developed against Recombinant Protein corresponding to amino acids: KRRWPISYCRELKGYSIPFMGSDVSVVRRTQRYLYENLEESPVQYAAYVTVG | |
100 μg | |
Amino Acids Drugs and other small molecules, Endocrinology, Signal Transduction | |
51097 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction