SCCPDH Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP31704225UL

Catalog No. NB169161

Description

SCCPDH Polyclonal antibody specifically detects SCCPDH in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: SCCPDH
• Classification: Polyclonal
• Dilution: Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: CGI-49, EC 1.5.1.9, FLJ43187, NET11, probable saccharopine dehydrogenase, RP11-439E19.2, saccharopine dehydrogenase (putative)
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KRRWPISYCRELKGYSIPFMGSDVSVVRRTQRYLYENLEESPVQYAAYVTVG
• Quantity: 25 μg
• Research Discipline: Amino Acids Drugs and other small molecules, Endocrinology, Signal Transduction
• Gene ID (Entrez): 51097
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified