Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SCF/c-kit Ligand Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25746325UL
Description
SCF/c-kit Ligand Polyclonal specifically detects SCF/c-kit Ligand in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SCF/c-kit Ligand | |
Polyclonal | |
Immunohistochemistry-Paraffin 1:200 - 1:500 | |
DKFZp686F2250, familial progressive hyperpigmentation 2, FPH2, KIT ligand, Kitl, KL-1, Mast cell growth factor, MGFSHEP7, SCFStem cell factor, SFc-Kit ligand, steel factor | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
KITLG | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YWKKRQPSLTRAVENIQINEEDNEISMLQEK | |
25 μL | |
Cancer, Embryonic Stem Cell Markers, Hematopoietic Stem Cell Markers, Immunology, Innate Immunity, Mesenchymal Stem Cell Markers, Stem Cell Markers | |
4254 | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction