Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SCL/Tal1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00

Specifications

Antigen	SCL/Tal1
Dilution	Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Applications	Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB392806 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP26897325UL	25 μL	Each of 1 for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

SCL/Tal1 Polyclonal antibody specifically detects SCL/Tal1 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

Antigen	SCL/Tal1
Applications	Immunofluorescence
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Phospho Specific
Formulation	PBS (pH 7.2) and 40% Glycerol
Gene ID (Entrez)	6886
Isotype	IgG
Purification Method	Protein A purified

Dilution	Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human
Gene Alias	BHLHA17, bHLHa17tal-1, Class A basic helix-loop-helix protein 17, SCLT-cell acute lymphocytic leukemia protein 1, Stem cell protein, TAL-1, T-cell acute lymphocytic leukemia 1, T-cell leukemia/lymphoma protein 5, TCL5tal-1 product
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: PDDLLQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADG
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

SCL/Tal1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents