Invitrogen™ SCN11A Polyclonal Antibody

Catalog No.	Quantity
PIPA5114378	100 μg

Catalog No. PIPA5114378 Supplier Invitrogen™ Supplier No. PA5114378

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human PC-3 whole cell, rat brain tissue, rat kidney tissue, rat C6 whole cell, mouse spleen tissue, mouse brain tissue, mouse kidney tissue. IHC: rat spleen tissue, mouse spleen tissue. Flow: U87 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Epithelial sodium channels are amiloride-sensitive members of the Degenerin/epithelial sodium channel (Deg/ENaC) superfamily of ion channels. Members of this superfamily of ion channels share organizational similarity in that they all possess two short intracellular amino and carboxyl termini, two short membrane spanning segments, and a large extracellular loop with a conserved cysteine-rich region. There are three homologous isoforms of the ENaC (alpha, beta, and gamma) protein. ENaC in the kidney, lung, and colon plays an essential role in trans-epithelial sodium and fluid balance. ENaC also mediates aldosterone-dependent sodium reabsorption in the distal nephron of the kidney, thus regulating blood pressure. ENaC is thought to be regulated, in part, through association with the cystic fibrosis transmembrane conductance regulator (CFTR) chloride ion channel. Gain-of-function mutations in beta- or gamma-ENaC can cause severe arterial hypertension (Liddels syndrome) and loss-of-function mutations in alpha- or beta-ENaC causes pseudohypoaldosteronism (PHA-1).

Specifications

• Antigen: SCN11A
• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
• Classification: Polyclonal
• Concentration: 500 μg/mL
• Conjugate: Unconjugated
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene: SCN11A
• Gene Accession No.: O88457, Q9R053, Q9UI33
• Gene Alias: FEPS3; hNaN; HSAN7; Nan; NaT; NaV1.9; NSS2; Peripheral nerve sodium channel 5; PN5; Scn11a; SCN12A; sensory neuron sodium channel 2; SNS2; SNS-2; Sodium channel protein type 11 subunit alpha; sodium channel protein type XI subunit alpha; sodium channel voltage-gated type 11 alpha polypeptide; sodium channel voltage-gated type XI alpha polypeptide; sodium channel, voltage gated, type XI alpha subunit; sodium channel, voltage-gated, type 11, alpha polypeptide; sodium channel, voltage-gated, type XI, alpha; sodium channel, voltage-gated, type XI, alpha polypeptide; sodium channel, voltage-gated, type XI, alpha subunit; sodium channel, voltage-gated, type XII, alpha polypeptide; sodium channel, voltage-gated, type11, alpha polypeptide; sodium voltage-gated channel alpha subunit 11; voltage-gated sodium channel NAV1.9b; voltage-gated sodium channel subunit alpha Nav1.9
• Gene Symbols: SCN11A
• Host Species: Rabbit
• Immunogen: A synthetic peptide corresponding to a sequence of human SCN11A (MDDRCYPVIFPDERNFRPFTSDSLAAIEKRIAIQKEKKK).
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 11280, 24046, 29701
• Target Species: Human, Mouse, Rat
• Content And Storage: -20°C
• Product Type: Antibody
• Form: Lyophilized
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov