Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SCP2/SYCP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$377.03 - $728.30
Specifications
| Antigen | SCP2/SYCP2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SCP2/SYCP2 Polyclonal specifically detects SCP2/SYCP2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| SCP2/SYCP2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| NLTP, non-specific lipid-transfer protein, NSL-TP, Propanoyl-CoA C-acyltransferase, SCP-2, SCP-CHI, SCPX, SCP-X, Sterol Carrier Protein 2, Sterol carrier protein X | |
| SYCP2 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 10388 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GERRANLLPKKLCKIEDADHHIHKMSESVSSLSTNDFSIPWETWQNEFAGIEMTYETYERLNSEFKRRNNIRHKMLSYFTTQSWKTAQQHLRTMNHQSQDSRI | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title