Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SCP3/SYCP3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00
Specifications
Antigen | SCP3/SYCP3 |
---|---|
Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
SCP3/SYCP3 Polyclonal antibody specifically detects SCP3/SYCP3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
SCP3/SYCP3 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Cell Biology, Cell Cycle and Replication, Chromatin Research, Growth and Development, Neuronal Cell Markers, Neuroscience, Neurotransmission | |
PBS (pH 7.2), 40% Glycerol | |
50511 | |
IgG | |
Immunogen affinity purified |
Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
MGC71888, SCP3, SCP-3, SCP3 chromosome 3 open reading frame 8, SCP3 COR1, synaptonemal complex protein 3 | |
This antibody was developed against a recombinant protein corresponding to amino acids: ILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title